TitleProduct

High Quality Floating Fish Feed Pellet for Catfish

  • Price:

    Negotiable

  • minimum:

  • Total supply:

  • Delivery term:

    The date of payment from buyers deliver within days

  • seat:

    Beijing

  • Validity to:

    Long-term effective

  • Last update:

    2017-12-30 06:54

  • Browse the number:

    116

Send an inquiries

Company Profile

Linhai Yufly Commercial Co. Ltd

By certification [File Integrity]

Contact: yataifeed(Ms.)  

Telephone:

Area: Beijing

Address: Beijing

Website: http://yataifeed.ehomey.net/

Product details
Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitativeandqualitative"andaccordingtotheweather,watertemperature,waterqualityandfeedingadjustfeedingamount,avoidfeedcausestoomuchwaste.Watertemperatureduring20cto30c:3-4times/day;below20c:1-2times/day;Feedrate:3-5%fishweightforstart;1-2%fishweightforgrower;3.Cleartheleftfeedintimetoavoidpollutionwater.Specification;
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
Shipping Information:
  • FOB Port: qingdao
  • Lead Time: 15 - 20 days
  • Dimensions per Unit: 0.8 × 0.5 × 0.8 Meters
  • Weight per Unit: 25.1 Kilograms
  • Units per Export Carton: 15
  • Export Carton Dimensions L/W/H: 5.8 × 2.3 × 2.3 Meters
  • Export Carton Weight: 15 Tons (US)
Main Export Markets:
  • Asia
  • Australasia
  • Central/South America
  • Eastern Europe
  • Mid East/Africa
  • North America
  • Western Europe